Structure of PDB 1b72 Chain B Binding Site BS02

Receptor Information

>1b72 Chain B (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWF
GNKRIRYKKNIGKFQEEANIYAA

Ligand information

>1b72 Chain E (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcagccgatcaatcatagag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1b72 Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
Resolution	2.35 Å
Binding residue (original residue number in PDB)	R235 R237 N239 Y260 R288 I289 K292
Binding residue (residue number reindexed from 1)	R1 R3 N5 Y26 R54 I55 K58

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1b72, PDBe:1b72, PDBj:1b72
PDBsum	1b72
PubMed	10052460
UniProt	P40424\|PBX1_HUMAN Pre-B-cell leukemia transcription factor 1 (Gene Name=PBX1)

[Back to BioLiP]