Structure of PDB 1az0 Chain B Binding Site BS02

Receptor Information
>1az0 Chain B (length=229) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLRSDLINALYDEDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKI
AEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNIKFTLGGY
TSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVSLKTYNIELNEIPKPYKGV
KVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYW
RNYERTSQLRNDKYNNISEYRNWIYRGRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1az0 Conformational transitions and structural deformability of EcoRV endonuclease revealed by crystallographic analysis.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		T37 N70 D90 K92 T93 T94 Y95 T106 G109 T111 S112 S183 T186 N188
Binding residue
(residue number reindexed from 1)		T32 N65 D85 K87 T88 T89 Y90 T96 G99 T101 S102 S167 T170 N172
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1az0, PDBe:1az0, PDBj:1az0
PDBsum1az0
PubMed9367757
UniProtP04390|T2E5_ECOLX Type II restriction enzyme EcoRV (Gene Name=ecoRVR)

[Back to BioLiP]