Structure of PDB 1a1a Chain B Binding Site BS02

Receptor Information
>1a1a Chain B (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYSLSVSDFDNA
KGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTV
CP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a1a Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
R158 R178 T182 S188 K203 H204 Y205 G239
Binding residue
(residue number reindexed from 1)
R11 R31 T35 S41 K56 H57 Y58 G92
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1a1a, PDBe:1a1a, PDBj:1a1a
PDBsum1a1a
PubMed9174343
UniProtP12931|SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]