Structure of PDB 1a0a Chain B Binding Site BS02

Receptor Information
>1a0a Chain B (length=63) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAA
CRYIRHLQQNGST
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a0a Crystal structure of PHO4 bHLH domain-DNA complex: flanking base recognition.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K1 E9 R12 R15
Binding residue
(residue number reindexed from 1)		K2 E10 R13 R16
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1a0a, PDBe:1a0a, PDBj:1a0a
PDBsum1a0a
PubMed9303313
UniProtP07270|PHO4_YEAST Phosphate system positive regulatory protein PHO4 (Gene Name=PHO4)

[Back to BioLiP]