Structure of PDB 4v7j Chain Ay Binding Site BS02

Receptor Information
>4v7j Chain Ay (length=94) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLAGMPDCY
KIKLRSSGYRLVYQVIDEKVVVFVISVGKAERSEVYSEAVKRIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7j The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K54 R56 R61 E82 S84 Y87
Binding residue
(residue number reindexed from 1)		K53 R55 R60 E81 S83 Y86
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0043022 ribosome binding
GO:0097351 toxin sequestering activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006402 mRNA catabolic process
GO:0017148 negative regulation of translation
GO:0034198 cellular response to amino acid starvation
GO:0040008 regulation of growth
GO:0044010 single-species biofilm formation
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
Cellular Component
GO:0032993 protein-DNA complex
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7j, PDBe:4v7j, PDBj:4v7j
PDBsum4v7j
PubMed20005802
UniProtP0C077|RELE_ECOLI mRNA interferase toxin RelE (Gene Name=relE)

[Back to BioLiP]