Structure of PDB 6hiv Chain At Binding Site BS02

Receptor Information
>6hiv Chain At (length=138) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ELLHPLPVRARKMEWLKRDAVEENEEILRRPYYTIKSYALPPAVGRQESI
HNSNNIRGGMHSSHSLDLIMRQPRRVKTPEQLRALRDRLRFIGVTGPMPQ
ATSVSTKSYTDTYGSRLRPRYPESWDTVPPHQPSRELL
Ligand information
>6hiv Chain UU (length=11) Species: 5702 (Trypanosoma brucei brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PPPPPPPPPPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hiv Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
Resolution7.8 Å
Binding residue
(original residue number in PDB)		L19 H20
Binding residue
(residue number reindexed from 1)		L3 H4
Enzymatic activity
Enzyme Commision number ?
External links