Structure of PDB 7o7y Chain Ao Binding Site BS02

Receptor Information
>7o7y Chain Ao (length=128) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLSRGLRRKQHSLLKRL
RKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPE
MIGHYLGEFSITYKPVKHGRPGIGATHS
Ligand information
>7o7y Chain AT (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgaaauagcucaguugggagagcguuagacugaagaucuaaagguccc
ugguucgaucccggguuucggcacca
<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o7y Structural basis of ribosomal frameshifting during translation of the SARS-CoV-2 RNA genome.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
T136 H137
Binding residue
(residue number reindexed from 1)
T126 H127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0097371 MDM2/MDM4 family protein binding
GO:1990948 ubiquitin ligase inhibitor activity
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000056 ribosomal small subunit export from nucleus
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
GO:1901798 positive regulation of signal transduction by p53 class mediator
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7o7y, PDBe:7o7y, PDBj:7o7y
PDBsum7o7y
PubMed34029205
UniProtG1U0Q2|RS15_RABIT Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]