Structure of PDB 7mpi Chain Al Binding Site BS02

Receptor Information

>7mpi Chain Al (length=50) Species: 4932 (Saccharomyces cerevisiae)

AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI

Ligand information

>7mpi Chain A4 (length=158)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauuu

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7mpi CryoEM structures of pseudouridine-free ribosome suggest impacts of chemical modifications on ribosome conformations.
• Resolution: 3.05 Å
• Binding residue (original residue number in PDB): F7 K12 K15 K18 Q19 R21 L23 P24 W26 I27 L29 R30 T31 I35 K40
• Binding residue (residue number reindexed from 1): F6 K11 K14 K17 Q18 R20 L22 P23 W25 I26 L28 R29 T30 I34 K39

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7mpi, PDBe:7mpi, PDBj:7mpi
• PDBsum: 7mpi
• PubMed: 35489333
• UniProt: P04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)