Structure of PDB 8a22 Chain Aj Binding Site BS02

Receptor Information
>8a22 Chain Aj (length=206) Species: 353565 (Polytomella magna) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPNYFVHLGNLRPNPGATQQRIREGRGLSSRRGVSCGMGFKGQKARGRSL
HMLYDGGQLGLVKFPVTRQIPSYEVLYNQLGVSKLVEFIQLGLLDHTKTI
TMKELLNAGCVSSLKYGVLLYGNVSLSFPINIEVTACDDRARRSIEAAGG
KVTRVYYTKDGLEGLLFPKRFTDKNLPLPRPAVAWHPKFDGKFDAVGQIP
PVYEAV
Ligand information
>8a22 Chain A3 (length=207) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuacaggcauuuaauucgaagcauagcgagcuaacguuuagcagguuugc
auaaauuaaauauauuaaaaaagcaagaccgcaaagguuucuguagcaau
agaaucuugugacuuaacguuaggggcgauaaaccaaucacgcuauggca
uagcuaaguuucugcgaaauauauuuagguauagcuuaaaaaacuuuaua
gauaaaa
..............<<.<..<<<<<<<.....<<<<<<.<<..<<<<<<<
.....<<<<.....>>>>....>>>>.>>>...<<<..<<<<........
>>>>.>>>....>>.>>>>>>...<<.......>>......>>>>>>...
>..>.>>............<<<<<....>>>>>.................
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a22 Structure of a mitochondrial ribosome with fragmented rRNA in complex with membrane-targeting elements.
Resolution2.91 Å
Binding residue
(original residue number in PDB)		T17 Q18 R20 G24 R25 G26 S28 G32 V33 C35 Q42 K43 R45 R47 L49 M51 Y53 D54 G55 Q57
Binding residue
(residue number reindexed from 1)		T18 Q19 R21 G25 R26 G27 S29 G33 V34 C36 Q43 K44 R46 R48 L50 M52 Y54 D55 G56 Q58
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 20:50:00 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8a22', asym_id = 'Aj', bs = 'BS02', title = 'Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8a22', asym_id='Aj', bs='BS02', title='Structure of a mitochondrial ribosome with fragm...rRNA in complex with membrane-targeting elements.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0006412,0015934', uniprot = '', pdbid = '8a22', asym_id = 'Aj'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0006412,0015934', uniprot='', pdbid='8a22', asym_id='Aj')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>