Structure of PDB 6gaw Chain Ai Binding Site BS02

Receptor Information
>6gaw Chain Ai (length=99) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSEYAVRMSRLSARLFGEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYP
NHNTYFALMGTLRFLGLYRDEHQDFRDEQLRLKKLRGKGKPRKGEGKRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gaw Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
R10 R13
Binding residue
(residue number reindexed from 1)
R7 R10
Enzymatic activity
Enzyme Commision number ?
External links