Structure of PDB 5aj4 Chain Ai Binding Site BS02

Receptor Information
>5aj4 Chain Ai (length=99) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSEYAVRMSRLSARLFGEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYP
NHNTYFALMGTLRFLGLYRDEHQDFRDEQLRLKKLRGKGKPRKGEGKRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5aj4 The complete structure of the 55S mammalian mitochondrial ribosome.
Resolution3.8 Å
Binding residue
(original residue number in PDB)
R10 R13 R17
Binding residue
(residue number reindexed from 1)
R7 R10 R14
Enzymatic activity
Enzyme Commision number ?
External links