Structure of PDB 3jbn Chain Ae Binding Site BS02

Receptor Information
>3jbn Chain Ae (length=43) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSIKRFRLKQRLGKCRRQNRPVPHWYRLKNTKRRHWRRTKLGL
Ligand information
>3jbn Chain AC (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcacagucuuaacgauggaugucuugguuccuacagcgaugaaggccgc
agcaaaaugcgauacgcaaugaaaauugcagugacugaaucaucagaaug
cugaauguaaacuacaccaauucccugggaauagugguacuccuacagaa
a
............................................<<<<<<
<<<....>>>>.....(.<<<<.....>>..........>>>>..)...>
>>....<<.....>><<<<<<<<<<.>>>>>>..>>>>............
.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
Resolution4.7 Å
Binding residue
(original residue number in PDB)		R6 F7 R8 R12 K15 R18 Q19 V23 P24 W26 Y27 L29 K30
Binding residue
(residue number reindexed from 1)		R5 F6 R7 R11 K14 R17 Q18 V22 P23 W25 Y26 L28 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum3jbn
PubMed26432834
UniProtC0H4H3

[Back to BioLiP]