Structure of PDB 3jbp Chain Ac Binding Site BS02

Receptor Information

>3jbp Chain Ac (length=89) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKAGKGTGSFGKRNGKTHFLCLRCGKRSYHLQKKKCASCGYPSAKKRRFN
WSVKAKRRNTTGTGRCRYIKTLRRKLKNKFTEGSTPKPK

Ligand information

>3jbp Chain AC (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agcacagucuuaacgauggaugucuugguuccuacagcgaugaaggccgc
agcaaaaugcgauacgcaaugaaaauugcagugacugaaucaucagaaug
cugaauguaaacuacaccaauucccugggaauagugguacuccuacagaa
a

............................................<<<<<<
.((.....>>>.....<.<<<<..<<.)).>>.......>>>>..>...>
>>....<<.....>><<<<<<<<<<.>>>>>>..>>>>............
.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.
Resolution	6.7 Å
Binding residue (original residue number in PDB)	F20 R24 Y30 L32 K35 T62 G63 G65 R66 C67 R68 Y69 I70 K71 R75 K78 N79 F81 S85 T86 P87 P89 K90
Binding residue (residue number reindexed from 1)	F19 R23 Y29 L31 K34 T61 G62 G64 R65 C66 R67 Y68 I69 K70 R74 K77 N78 F80 S84 T85 P86 P88 K89

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbp, PDBe:3jbp, PDBj:3jbp
PDBsum	3jbp
PubMed	26432834
UniProt	C0H4L5

[Back to BioLiP]