Structure of PDB 3jbn Chain Ac Binding Site BS02

Receptor Information
>3jbn Chain Ac (length=89) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAGKGTGSFGKRNGKTHFLCLRCGKRSYHLQKKKCASCGYPSAKKRRFN
WSVKAKRRNTTGTGRCRYIKTLRRKLKNKFTEGSTPKPK
Ligand information
>3jbn Chain AC (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcacagucuuaacgauggaugucuugguuccuacagcgaugaaggccgc
agcaaaaugcgauacgcaaugaaaauugcagugacugaaucaucagaaug
cugaauguaaacuacaccaauucccugggaauagugguacuccuacagaa
a
............................................<<<<<<
<<<....>>>>.....(.<<<<.....>>..........>>>>..)...>
>>....<<.....>><<<<<<<<<<.>>>>>>..>>>>............
.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
Resolution4.7 Å
Binding residue
(original residue number in PDB)
F20 R24 C25 Y30 K35 Y42 A45 N60 T61 T62 G63 T64 G65 R66 C67 R68 Y69 I70 R75 K76 K78 N79 F81 G84 S85 T86 P87 K90
Binding residue
(residue number reindexed from 1)
F19 R23 C24 Y29 K34 Y41 A44 N59 T60 T61 G62 T63 G64 R65 C66 R67 Y68 I69 R74 K75 K77 N78 F80 G83 S84 T85 P86 K89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum3jbn
PubMed26432834
UniProtC0H4L5

[Back to BioLiP]