Structure of PDB 8fmw Chain Ab Binding Site BS02

Receptor Information
>8fmw Chain Ab (length=100) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKRKLRLQLKKARFNASRSRSKNKCFIKRMENNRKIISKNNINVQVFLVR
SLIGKLNKKVKVLKALGLNKIGDKKVHFLNESIKGMLNETINMILLSEVM
Ligand information
>8fmw Chain AB (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cccuggugguuaaagaaaagaggaaacaccuguuaucauuccgaacacag
aaguuaagcucuuauucgcugaugguacugcgaguucgcgggagaguagg
uuauugccaggg
.<<<<<<<<.....<<.<<<<<.....<<<<<...............>>>
..>>....>>>>>..>><<<.......<<<<<....>>>>>.......>>
>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fmw The structure of a hibernating ribosome in a Lyme disease pathogen.
Resolution2.86 Å
Binding residue
(original residue number in PDB)		R19 N24 F27 I28 R35 R51 K60 N93
Binding residue
(residue number reindexed from 1)		R18 N23 F26 I27 R34 R50 K59 N92
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 16:42:59 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8fmw', asym_id = 'Ab', bs = 'BS02', title = 'The structure of a hibernating ribosome in a Lyme disease pathogen.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8fmw', asym_id='Ab', bs='BS02', title='The structure of a hibernating ribosome in a Lyme disease pathogen.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0006412,0015934', uniprot = '', pdbid = '8fmw', asym_id = 'Ab'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0006412,0015934', uniprot='', pdbid='8fmw', asym_id='Ab')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>