Structure of PDB 7zrs Chain AZ Binding Site BS02

Receptor Information
>7zrs Chain AZ (length=82) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGG
SLARIALRHLEKEGIIKPISKHSKQAIYTRAT
Ligand information
>7zrs Chain 6 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uccgauauagcguaacggcuaucacaucacgcuuucaccguggagaccgg
gguucgacuccccguaucggagcca
<<<<<<<..<.<..........>.>.<<<<<.......>>>>>....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zrs Structural basis for clearing of ribosome collisions by the RQT complex.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		K25 W27
Binding residue
(residue number reindexed from 1)		K2 W4
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7zrs, PDBe:7zrs, PDBj:7zrs
PDBsum7zrs
PubMed36801861
UniProtQ3E792|RS25A_YEAST Small ribosomal subunit protein eS25A (Gene Name=RPS25A)

[Back to BioLiP]