Structure of PDB 3jbn Chain AZ Binding Site BS02

Receptor Information

>3jbn Chain AZ (length=121) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KFNKQKSSSRRKMRKAHFTAPAGLRRKIMSSKLSKELRLKYKTRSLPVRK
DDEVLICRGHNHGREGKVVKINRKRYKIYVERVTREKVNGESTFIGIHPS
NVVLTKLKVDKNRKKILDRKA

Ligand information

>3jbn Chain AC (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agcacagucuuaacgauggaugucuugguuccuacagcgaugaaggccgc
agcaaaaugcgauacgcaaugaaaauugcagugacugaaucaucagaaug
cugaauguaaacuacaccaauucccugggaauagugguacuccuacagaa
a

............................................<<<<<<
<<<....>>>>.....(.<<<<.....>>..........>>>>..)...>
>>....<<.....>><<<<<<<<<<.>>>>>>..>>>>............
.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
Resolution	4.7 Å
Binding residue (original residue number in PDB)	R12 R15 K16 F19 A23 R27 R50 K51 R74 K75 D111 N113 K116
Binding residue (residue number reindexed from 1)	R11 R14 K15 F18 A22 R26 R49 K50 R73 K74 D110 N112 K115

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum	3jbn
PubMed	26432834
UniProt	O77364

[Back to BioLiP]