Structure of PDB 7p5x Chain AY Binding Site BS02

Receptor Information
>7p5x Chain AY (length=124) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSKVERLMNLVIALLSTRTYLPAEKIRTTVAGYADSPSDEAFSRMFERDK
NELRDLGIPLETGRVSKWDSTEGYRINRDSYALPPIGLTADEAAAVAVAT
QLWQSPELVTATQNAVLKLRAAGV
Ligand information
>7p5x Chain AP (length=43) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tccgatcggtaccggacatgtaaagagcagaccaccgacaagt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p5x Transcriptional control of mycobacterial DNA damage response by sigma adaptation.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R46 E49 K52 R56 T64 Y76
Binding residue
(residue number reindexed from 1)		R44 E47 K50 R54 T62 Y74
Enzymatic activity
Enzyme Commision number ?
External links