Structure of PDB 4v95 Chain AY Binding Site BS02

Receptor Information
>4v95 Chain AY (length=132) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEY
YKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTE
KKARRPTRPTRASKERRLASKAQKSSVKAMRG
Ligand information
>4v95 Chain AV (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v95 Structural basis for the rescue of stalled ribosomes: structure of YaeJ bound to the ribosome.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G26 G27 Q28 Y77 R78
Binding residue
(residue number reindexed from 1)		G25 G26 Q27 Y76 R77
Enzymatic activity
Enzyme Commision number 3.1.1.29: peptidyl-tRNA hydrolase.
Gene Ontology
Molecular Function
GO:0003747 translation release factor activity
GO:0004045 aminoacyl-tRNA hydrolase activity
GO:0016787 hydrolase activity
GO:0043022 ribosome binding
Biological Process
GO:0006415 translational termination
GO:0006417 regulation of translation
GO:0072344 rescue of stalled ribosome
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v95, PDBe:4v95, PDBj:4v95
PDBsum4v95
PubMed22422986
UniProtP40711|ARFB_ECOLI Peptidyl-tRNA hydrolase ArfB (Gene Name=arfB)

[Back to BioLiP]