Structure of PDB 4v8x Chain AY Binding Site BS02

Receptor Information
>4v8x Chain AY (length=84) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKH
NLSGFWSRRITEEHRLVYAVTDDSLLIAACRYHY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v8x Yoeb-Ribosome Structure: A Canonical Rnase that Requires the Ribosome for its Specific Activity.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		E46 N51 R59 E62 E63 R65 H83 Y84
Binding residue
(residue number reindexed from 1)		E46 N51 R59 E62 E63 R65 H83 Y84
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0016892 RNA endonuclease activity, producing 3'-phosphomonoesters
GO:0042803 protein homodimerization activity
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006401 RNA catabolic process
GO:0006402 mRNA catabolic process
GO:0009408 response to heat
GO:0040008 regulation of growth
GO:0044010 single-species biofilm formation
GO:0045947 negative regulation of translational initiation
GO:0098795 global gene silencing by mRNA cleavage
Cellular Component
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8x, PDBe:4v8x, PDBj:4v8x
PDBsum4v8x
PubMed23945936
UniProtP69348|YOEB_ECOLI Toxin YoeB (Gene Name=yoeB)

[Back to BioLiP]