Structure of PDB 4ujd Chain AY Binding Site BS02

Receptor Information
>4ujd Chain AY (length=127) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIR
KDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH
PSKVVITRLKLDKDRKKILERKAKSRQ
Ligand information
>4ujd Chain A3 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>.............>>>..)...>>
>....<<<..>>><<<<<<<<<.....>>>>>>>>>..............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ujd Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires
Resolution8.9 Å
Binding residue
(original residue number in PDB)
R15 K16 F19 S23 H24 R27 K51 Q72 Y74 R75 K76 L111 D112 K113 D114 R115 K116 I118
Binding residue
(residue number reindexed from 1)
R15 K16 F19 S23 H24 R27 K51 Q72 Y74 R75 K76 L111 D112 K113 D114 R115 K116 I118
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Mar 7 06:04:53 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4ujd', asym_id = 'AY', bs = 'BS02', title = 'Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4ujd', asym_id='AY', bs='BS02', title='Structure of the Mammalian 80S Initiation Complex with Eif5B on Hcv Ires')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015934', uniprot = '', pdbid = '4ujd', asym_id = 'AY'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015934', uniprot='', pdbid='4ujd', asym_id='AY')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>