Structure of PDB 6uz7 Chain AX Binding Site BS02

Receptor Information
>6uz7 Chain AX (length=121) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KALKVRTSASFRLPKTLKLARSPKYATKAVPHYNRLDSYKVIEQPITSET
AMKKVEDGNTLVFKVSLKANKYQIKKAVKELYEVDVLSVNTLVRPNGTKK
AYVRLTADFDALDIANRIGYI
Ligand information
>6uz7 Chain 8 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaauugcgauauguauugugaauugcagauuuucgugaaucaucaaaucu
uugaacgcacauugcgcccucugguauuccagggggcaugccuguuugag
cgucauu
.........................................<<<<<<.<<
.....>>>.....<..<<......>>..............>>...>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uz7 Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		K22 K25 T37 L38 R42 H53 Y54 N55 R56 K61 K89 Y93 Q94
Binding residue
(residue number reindexed from 1)		K1 K4 T16 L17 R21 H32 Y33 N34 R35 K40 K68 Y72 Q73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uz7, PDBe:6uz7, PDBj:6uz7
PDBsum6uz7
PubMed31900355
UniProtP48045|RL25_KLULA Large ribosomal subunit protein uL23 (Gene Name=RPL25)

[Back to BioLiP]