Structure of PDB 4v6p Chain AX Binding Site BS02

Receptor Information
>4v6p Chain AX (length=70) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKAS
AVKRHAKKLARENARRTRLY
Ligand information
>4v6p Chain AC (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggauaagugcauuauguuuauguggugauuugcccuucuguagcca
...............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6p Structural characterization of mRNA-tRNA translocation intermediates.
Resolution13.5 Å
Binding residue
(original residue number in PDB)		V5 N8 R16 R17 F18 K19 R20 S21 K24 A25 L28 A29 V31 R33 E43 R44 R46
Binding residue
(residue number reindexed from 1)		V5 N8 R16 R17 F18 K19 R20 S21 K24 A25 L28 A29 V31 R33 E43 R44 R46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6p, PDBe:4v6p, PDBj:4v6p
PDBsum4v6p
PubMed22467828
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]