Structure of PDB 5a9z Chain AW Binding Site BS02

Receptor Information
>5a9z Chain AW (length=180) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQ
ASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYV
PLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSL
HASDLKLPPGVELAVSPEETIAAVVPPEDV
Ligand information
>5a9z Chain AB (length=123) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcgggggau
..<<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>
>>>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>
..>....>>>.>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5a9z Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
Resolution4.7 Å
Binding residue
(original residue number in PDB)		E11 R19 V27 Y29 R31 H32 N34 K36 R72 Q73 N75 K78 E84 H85 D87 F89 E97
Binding residue
(residue number reindexed from 1)		E11 R19 V27 Y29 R31 H32 N34 K36 R72 Q73 N75 K78 E84 H85 D87 F89 E97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a9z, PDBe:5a9z, PDBj:5a9z
PDBsum5a9z
PubMed26283392
UniProtQ5SHZ1|RL25_THET8 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]