Structure of PDB 3jbn Chain AW Binding Site BS02

Receptor Information

>3jbn Chain AW (length=170) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

YAKKIRNLGKCAKGAGVDLRVHFKNTYEAARAIRRMKLLEAKKYLNDVIE
KKRCVPFRKYNGGVGRTNQAKEFNHTQGRWPAKSCKFLLNILDNVQANAE
SRNLDVSKLRLIHVMVNKARPGRRRTYKAHGRINPFMSSPCHIQIIAREI
NAAAAAAAAAAAAAAAAAAA

Ligand information

>3jbn Chain AC (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agcacagucuuaacgauggaugucuugguuccuacagcgaugaaggccgc
agcaaaaugcgauacgcaaugaaaauugcagugacugaaucaucagaaug
cugaauguaaacuacaccaauucccugggaauagugguacuccuacagaa
a

............................................<<<<<<
<<<....>>>>.....(.<<<<.....>>..........>>>>..)...>
>>....<<.....>><<<<<<<<<<.>>>>>>..>>>>............
.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
Resolution	4.7 Å
Binding residue (original residue number in PDB)	R61 K62 R113 R123 H145 N154
Binding residue (residue number reindexed from 1)	R58 K59 R110 R120 H142 N151

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum	3jbn
PubMed	26432834
UniProt	Q8IDI5

[Back to BioLiP]