Structure of PDB 4v7c Chain AU Binding Site BS02

Receptor Information
>4v7c Chain AU (length=51) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAV
K
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7c Structure of the ribosome with elongation factor G trapped in the pretranslocation state.
Resolution7.6 Å
Binding residue
(original residue number in PDB)		A25 A29
Binding residue
(residue number reindexed from 1)		A23 A27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7c, PDBe:4v7c, PDBj:4v7c
PDBsum4v7c
PubMed24324137
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]