Structure of PDB 4v6q Chain AU Binding Site BS02

Receptor Information
>4v6q Chain AU (length=74) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKY
QRQLARAIKRARYLSLLPYTDRHQ
Ligand information
>4v6q Chain AC (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggauaagugcauuauguuuauguggugauuugcccuucuguagcca
...............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6q Structural characterization of mRNA-tRNA translocation intermediates.
Resolution11.5 Å
Binding residue
(original residue number in PDB)		I25 K29 N30 I32 E34 I43 Q74
Binding residue
(residue number reindexed from 1)		I25 K29 N30 I32 E34 I43 Q74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6q, PDBe:4v6q, PDBj:4v6q
PDBsum4v6q
PubMed22467828
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]