Structure of PDB 7aoi Chain AT Binding Site BS02

Receptor Information
>7aoi Chain AT (length=138) Species: 5691 (Trypanosoma brucei) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GYTRERTNRHFFVARANAFFSRLPIARVQRSLAMEAVREGRMRPWKYTKE
QILGAPVTCNFEYNPRPVRLIGTVMDAHTEETSIKGGLKVYARNEETNMM
LWIPPGNPKLRHEVTSTKGSFQHYLDERDKWDEAWITG
Ligand information
>7aoi Chain UJ (length=25) Species: 5691 (Trypanosoma brucei) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aoi Interconnected assembly factors regulate the biogenesis of mitoribosomal large subunit.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		K131 E134
Binding residue
(residue number reindexed from 1)		K130 E133
Enzymatic activity
Enzyme Commision number ?
External links