Structure of PDB 8hky Chain AS7P Binding Site BS02

Receptor Information
>8hky Chain AS7P (length=193) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENIEVSNLNVKVFGKWDTKVEVRDPSLKKYIDLMSIYLPHTGGRHEHRRF
GKSRIPIVERLINNLMRPGRNKGKKMLAYNIVKTTFDIIAVKTGQNPIQV
LVRAIENAAPREEVTRIMYGGIVYYVAVDVAPQRRVDLALRHLVTGASEA
SFNNPKPIEEALAEEIIAAANNDNKSVAIRKKEEIERIALSSR
Ligand information
>8hky Chain AETN (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca
<<<<<<...<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>.>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hky Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
Resolution4.45 Å
Binding residue
(original residue number in PDB)
V125 E186 R189
Binding residue
(residue number reindexed from 1)
V123 E184 R187
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8hky, PDBe:8hky, PDBj:8hky
PDBsum8hky
PubMed37604686
UniProtP17198|RS7_SULAC Small ribosomal subunit protein uS7 (Gene Name=rps7)

[Back to BioLiP]