Structure of PDB 6p5j Chain AS Binding Site BS02

Receptor Information
>6p5j Chain AS (length=176) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKASGTLREYKVVGRCLPTSKSPAPPLYRMRIFAPNHVVAKSRFWYFVLE
LKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYHEYRDL
IMASAVTQCYRDMGARHRARAHSIQVMKVEEMAAARCPRPAVKQFHDSRI
RFPLPHRVLRRQHKPRFTAKRPNTFF
Ligand information
>6p5j Chain 7 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcu
<<<<<<<<<....<<<<<<<<.....<<<<<.....<.....>..>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p5j The Israeli acute paralysis virus IRES captures host ribosomes by mimicking a ribosomal state with hybrid tRNAs.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		S42 R43 Y46 L49 K52 K53 K55 S57 D85 R87 R120 H122
Binding residue
(residue number reindexed from 1)		S42 R43 Y46 L49 K52 K53 K55 S57 D85 R87 R120 H122
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Dec 2 20:13:14 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6p5j', asym_id = 'AS', bs = 'BS02', title = 'The Israeli acute paralysis virus IRES captures ...by mimicking a ribosomal state with hybrid tRNAs.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6p5j', asym_id='AS', bs='BS02', title='The Israeli acute paralysis virus IRES captures ...by mimicking a ribosomal state with hybrid tRNAs.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6p5j', asym_id = 'AS'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6p5j', asym_id='AS')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>