Structure of PDB 4v7k Chain AS Binding Site BS02

Receptor Information

>4v7k Chain AS (length=98) Species: 300852 (Thermus thermophilus HB8)

KFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKG
NKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREG

Ligand information

>4v7k Chain AB (length=119)

ucccccgugcccauagcggcguggaaccacccguucccauuccgaacacg
gaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccuggga
gaguaggucggugcggggg

.<<<<<<<<<<....<<<<<<<<....<<<<<<...............>>
>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>..
.....>>>.>>>>>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4v7k The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): R17 R25 F29 S31 L32 K33 H34 Q38 V46 T47 S50 A55 K62 T63 K93 H95
• Binding residue (residue number reindexed from 1): R7 R15 F19 S21 L22 K23 H24 Q28 V36 T37 S40 A45 K52 T53 K83 H85

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7k, PDBe:4v7k, PDBj:4v7k
• PDBsum: 4v7k
• PubMed: 20005802
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)