BioLiP

Receptor Information

>3jbp Chain AR (length=252) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KVVKNKAYFKRYQVKYRRRREGKTDYRARKALILQDKNKYNAQKLRFVVR
KTNSQVICQIACAHIEGDKILAEAKSKELIRYGIPVGLKNYAAAYATGLL
CARRFLKSLNLDTQFLGVEKVTRKPIKAFLDVGITRTTTGNRVFAALKGA
CDGGLNIPHGNNRFPGSFNPEQLRKNILGIHVAEYMKTLQEEDNDKYKTH
FNDYLKNNIGADDIEQMYLNAHEKIRQNPKKLNAKLRKKRVKEKLALYVE
LQ

>3jbp Chain AB (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gacucguucauacuacaguggauacaccagaucccaucagaacucugaag
uuaagcacuguaaggcuuggcuaguacugaggugggagaccgcucgggaa
caccaggugaugagucag

<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..>
>....>>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>...
..>>>>>>>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.
Resolution	6.7 Å
Binding residue (original residue number in PDB)	K10 F13 K14 Y20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 K55 T56 N57 S58 Q59 Q63 E70 G71 D72 K73 I74 K79 K81 K93 N94 Y95 T153 R154 N159 R160 Y206 H221 F222 N223 D224 Y225 K271 K272 L273 A275 R278 R281 V282 K285
Binding residue (residue number reindexed from 1)	K6 F9 K10 Y16 R17 R18 R20 K23 T24 Y26 R29 R46 R50 K51 T52 N53 S54 Q55 Q59 E66 G67 D68 K69 I70 K75 K77 K89 N90 Y91 T135 R136 N141 R142 Y185 H200 F201 N202 D203 Y204 K230 K231 L232 A234 R237 R240 V241 K244

Enzyme Commision number

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:3jbp, PDBe:3jbp, PDBj:3jbp
PDBsum	3jbp
PubMed	26432834
UniProt	Q8ILL3

[Back to BioLiP]

Structure of PDB 3jbp Chain AR Binding Site BS02