Structure of PDB 8aa5 Chain AP1 Binding Site BS02

Receptor Information
>8aa5 Chain AP1 (length=445) Species: 34078 (Scytonema hofmannii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNVIATQLSEEAQVKLEVIQSLLEPCDRTTYGQKLREAAEKLNVSLRTVQ
RLVKNWEQDGLVGLTQTSRADKGKHRIGEFWENFITKTYKEGNKGSKRMT
PKQVALRVEAKARELKDSKPPNYKTVLRVLAPILEKQQKAKSIRSPGWRG
TTLSVKTREGKDLSVDYSNHVWQCDHTRVDVLLVDQHGEILSRPWLTTVI
DTYSRCIMGINLGFDAPSSGVVALALRHAILPKRYGSEYKLHCEWGTYGK
PEHFYTDGGKDFRSNHLSQIGAQLGFVCHLRDRPSEGGVVERPFKTLNDQ
LFSTLPGYTGSNVQERPEDAEKDARLTLRELEQLLVRYIVDRYNQSIDAR
MGDQTRFERWEAGLPTVPVPIPERDLDICLMKQSRRTVQRGGCLQFQNLM
YRGEYLAGYAGETVNLRFDPRDITTILVYRQENNQEVFLTRAHAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8aa5 Structure of the TnsB transposase-DNA complex of type V-K CRISPR-associated transposon.
Resolution2.46 Å
Binding residue
(original residue number in PDB)
R174 S175 P176 G177 W178 S315 G318 V319 R322 Q330 A379 R380
Binding residue
(residue number reindexed from 1)
R144 S145 P146 G147 W148 S285 G288 V289 R292 Q300 A349 R350
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 13:50:26 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '8aa5', asym_id = 'AP1', bs = 'BS02', title = 'Structure of the TnsB transposase-DNA complex of type V-K CRISPR-associated transposon.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='8aa5', asym_id='AP1', bs='BS02', title='Structure of the TnsB transposase-DNA complex of type V-K CRISPR-associated transposon.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0015074', uniprot = '', pdbid = '8aa5', asym_id = 'AP1'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0015074', uniprot='', pdbid='8aa5', asym_id='AP1')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>