Structure of PDB 7qi5 Chain AP Binding Site BS02

Receptor Information

>7qi5 Chain AP (length=97) Species: 9606 (Homo sapiens)

SNEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRH
ITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE

Ligand information

• Ligand ID: FES
• InChI: InChI=1S/2Fe.2S
• InChIKey: NIXDOXVAJZFRNF-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04: [Fe]1S[Fe]S1
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: S1[Fe]S[Fe]1
• Formula: Fe2 S2
• Name: FE2/S2 (INORGANIC) CLUSTER
• PDB chain: 7qi5 Chain AP Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
• Resolution: 2.63 Å
• Binding residue (original residue number in PDB): C65 C68 C100 K102 K103
• Binding residue (residue number reindexed from 1): C20 C23 C55 K57 K58
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
• PDBsum: 7qi5
• PubMed: 38769321
• UniProt: Q9Y3D5|RT18C_HUMAN Small ribosomal subunit protein bS18m (Gene Name=MRPS18C)