Structure of PDB 6ztl Chain AP Binding Site BS02

Receptor Information

>6ztl Chain AP (length=82) Species: 562 (Escherichia coli)

MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNKAA

Ligand information

• Ligand ID: MG
• InChI: InChI=1S/Mg/q+2
• InChIKey: JLVVSXFLKOJNIY-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Mg+2]
  CACTVS 3.341: [Mg++]
• Formula: Mg
• Name: MAGNESIUM ION
• DrugBank: DB01378
• PDB chain: 6ztl Chain AP Residue 101

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ztl Structural basis of transcription-translation coupling and collision in bacteria.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): E34 R35 V36
• Binding residue (residue number reindexed from 1): E34 R35 V36
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000400 four-way junction DNA binding
• GO:0003735 structural constituent of ribosome
• GO:0004519 endonuclease activity
• GO:0004520 DNA endonuclease activity

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006259 DNA metabolic process
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ztl, PDBe:6ztl, PDBj:6ztl
• PDBsum: 6ztl
• PubMed: 32820062
• UniProt: P0A7T3|RS16_ECOLI Small ribosomal subunit protein bS16 (Gene Name=rpsP)