Structure of PDB 6uz7 Chain AP Binding Site BS02

Receptor Information

>6uz7 Chain AP (length=180) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RYGATSTNPAKSASARGSYLRVSYKNTRETAQAISGWNLQKAQKYLDQVL
DHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAASNA
EAKGLDATRLYVSHIQVNQAPKQRRRTFRAHGRINKYESSPSHIELVVTE
KEEAVEKASEKKVARLSSRQRGRLATQKRI

Ligand information

>6uz7 Chain 8 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaauugcgauauguauugugaauugcagauuuucgugaaucaucaaaucu
uugaacgcacauugcgcccucugguauuccagggggcaugccuguuugag
cgucauu

.........................................<<<<<<.<<
.....>>>.....<..<<......>>..............>>...>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6uz7 Long-range interdomain communications in eIF5B regulate GTP hydrolysis and translation initiation.
Resolution	3.6 Å
Binding residue (original residue number in PDB)	Y4 G5 A6 R30 R61 N120 Q121
Binding residue (residue number reindexed from 1)	Y2 G3 A4 R28 R59 N118 Q119

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6uz7, PDBe:6uz7, PDBj:6uz7
PDBsum	6uz7
PubMed	31900355
UniProt	Q6CXQ6

[Back to BioLiP]