Structure of PDB 5aa0 Chain AP Binding Site BS02

Receptor Information

>5aa0 Chain AP (length=110) Species: 300852 (Thermus thermophilus HB8)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

Ligand information

>5aa0 Chain AB (length=123)

aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcgggggau

..<<<<<<<<<<<....<<<<<<<<....<<<<<<<.............>
>>>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>
..>....>>>.>>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5aa0 Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
• Resolution: 5.0 Å
• Binding residue (original residue number in PDB): R25 S27 F29 R30 L32 K33 H34 Y36 Q38 E43 G45 T47 S50 S53 K59 G60 N61 T63 Y92 K93 H95 G96 R97
• Binding residue (residue number reindexed from 1): R23 S25 F27 R28 L30 K31 H32 Y34 Q36 E41 G43 T45 S48 S51 K57 G58 N59 T61 Y90 K91 H93 G94 R95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5aa0, PDBe:5aa0, PDBj:5aa0
• PDBsum: 5aa0
• PubMed: 26283392
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)