Structure of PDB 7qi6 Chain AO Binding Site BS02

Receptor Information

>7qi6 Chain AO (length=193) Species: 9606 (Homo sapiens)

PISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIR
RNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQ
HKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSG
DPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7qi6 Chain AO Residue 301

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7qi6 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
• Resolution: 2.98 Å
• Binding residue (original residue number in PDB): C94 C105 C108 C143
• Binding residue (residue number reindexed from 1): C48 C59 C62 C97
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0030054 cell junction
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qi6, PDBe:7qi6, PDBj:7qi6
• PDBsum: 7qi6
• PubMed: 38769321
• UniProt: Q9Y676|RT18B_HUMAN Small ribosomal subunit protein mS40 (Gene Name=MRPS18B)