Structure of PDB 8oeq Chain AM Binding Site BS02

Receptor Information
>8oeq Chain AM (length=50) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSQKSFRTKQKLAKAQKQNRPLPQWIRLRTDNKIRYNAKRRHWRRTKLGI
Ligand information
>8oeq Chain 4 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguu
.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
Resolution3.3 Å
Binding residue
(original residue number in PDB)		F7 R8 Q11 K12 K15 Q19 R21 L23 W26 L29 R30 T31 I35 N38 K40
Binding residue
(residue number reindexed from 1)		F6 R7 Q10 K11 K14 Q18 R20 L22 W25 L28 R29 T30 I34 N37 K39
External links
PDB RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
PDBsum8oeq
PubMed
UniProtQ96W55|RL39_CANAX Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]