Structure of PDB 6fxc Chain AM Binding Site BS02

Receptor Information
>6fxc Chain AM (length=119) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKG
VTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYL
YHGRVKALAEAARESGLEF
Ligand information
>6fxc Chain AB (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaagcuccuuagcgucgaugguagucgaacuuacguuccgcuagagu
agaacguugccaggc
<<<<<<<<<....<<<<<<<<.....<<<<<...............>>>.
.>>....>>>>>>.>>.<<......<<<.<<<<....>>>>.>>>.....
.>>..>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6fxc The cryo-EM structure of hibernating 100S ribosome dimer from pathogenic Staphylococcus aureus.
Resolution6.76 Å
Binding residue
(original residue number in PDB)		K4 D6 K7 K9 R11 H15 R19 N32 Y34 R35 S36 N37 K38 V51 T52 Q55 T68 K69 V70 H102 G103 R104
Binding residue
(residue number reindexed from 1)		K4 D6 K7 K9 R11 H15 R19 N32 Y34 R35 S36 N37 K38 V51 T52 Q55 T68 K69 V70 H102 G103 R104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fxc, PDBe:6fxc, PDBj:6fxc
PDBsum6fxc
PubMed28959035
UniProtW8TRE0

[Back to BioLiP]