Structure of PDB 6eri Chain AM Binding Site BS02

Receptor Information
>6eri Chain AM (length=134) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSPKRTRFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAG
RRAMTRNARRGGKIWVRIFPDKPVTVRPAETRMGSGKGSPEYWVAVVKPG
RILYEISGVAENIARRAVAIAASKMPIRTQFIIS
Ligand information
>6eri Chain Ax (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uucugguguccuaggcguagaggaaccacaccaauccaucccgaacuugg
ugguuaaacucuacugcggugacgauacuguaggggagguccugcggaaa
aauagcucgacgccagga
<<<<<<<<<<....<<<<<<<<.....<<<<<<<............>>>>
>.>>....>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>...
....>>>.>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6eri Structure of the chloroplast ribosome with chl-RRF and hibernation-promoting factor.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		M17 K18 G19 Y22
Binding residue
(residue number reindexed from 1)		M17 K18 G19 Y22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0009507 chloroplast
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6eri, PDBe:6eri, PDBj:6eri
PDBsum6eri
PubMed29610536
UniProtP17353|RK16_SPIOL Large ribosomal subunit protein uL16c (Gene Name=rpl16)

[Back to BioLiP]