Structure of PDB 8hkz Chain ALX0 Binding Site BS02

Receptor Information
>8hkz Chain ALX0 (length=76) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKIFMVRGTAIFSASRFPTSQKFTKYVRALNEKQAIEYIYSQLGGKNKIK
RYNIHIQEIKEVKEDEITDKTIRDLA
Ligand information
>8hkz Chain A5S (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcccacccggucauagugagcggguaacacccggacucguuucgaaccc
ggaaguuaagccgcucacgucagaggggccgugggauccgagagggcccg
cagccucucugagcugggaugg
......<<.<......<<<<<<<<.....<<<<<...............>
>>..>>....>>>>>>>>.<<<<<.<<<<.<<<<<..<<....>>.>>>>
>.>>>>.>>>>>..>.>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
Resolution4.78 Å
Binding residue
(original residue number in PDB)		I14 Y55
Binding residue
(residue number reindexed from 1)		I11 Y52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtP38613|RL18A_SULAC Large ribosomal subunit protein eL20 (Gene Name=rpl18a)

[Back to BioLiP]