Structure of PDB 8hl1 Chain AL5P Binding Site BS02

Receptor Information
>8hl1 Chain AL5P (length=168) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KENVMRRVVLDKVTVNIGVGESGERLQKAYQLVQELTGVKPVYTKGRKSI
REFGVRKGAPIGVKATLRRQAAVEFLKKVLPAVNFRLKQSSFDNYGNVSF
GIAEHVLIPGTRYDPEIGIFGMDVAITLVRPGYRTMKRKRKKASIPRRHR
VTKEEAINFMKENFNVTI
Ligand information
>8hl1 Chain A5S (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcccacccggucauagugagcggguaacacccggacucguuucgaaccc
ggaaguuaagccgcucacgucagaggggccgugggauccgagagggcccg
cagccucucugagcugggaugg
..<<..<<<<<.....<<<<<<<<.....<<<<<<.............>>
>>..>>....>>>>>>>>.<<<<<<<<<<.<<<<<..<<....>>.>>>>
>.>>>>>>>>>>.>>>>>..>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hl1 Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
Resolution3.93 Å
Binding residue
(original residue number in PDB)		K8 E9 M12 R13 K47 V49 K71 T73 R75 R76 G139 R141 R145 R147 P153 R154 R155 H156
Binding residue
(residue number reindexed from 1)		K1 E2 M5 R6 K40 V42 K64 T66 R68 R69 G132 R134 R138 R140 P146 R147 R148 H149
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hl1, PDBe:8hl1, PDBj:8hl1
PDBsum8hl1
PubMed37604686
UniProtP41202|RL5_SULAC Large ribosomal subunit protein uL5 (Gene Name=rpl5)

[Back to BioLiP]