Structure of PDB 7tor Chain AL39 Binding Site BS02

Receptor Information
>7tor Chain AL39 (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL
Ligand information
>7tor Chain A58S (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcagguugaucaucgacacuucgaac
gcacuugcggccccggguuccucccggggcuacgccugucugagcgucgc
u
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>........>>>..>...>>>....
<<<..>>><<<<<<<<.......>>>>>>>>...................
.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tor Ribosome inhibition by C9ORF72-ALS/FTD-associated poly-PR and poly-GR proteins revealed by cryo-EM.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R8 K15 K18 Q19 R21 I23 P24 W26 I27 M29 T31 I35 K40
Binding residue
(residue number reindexed from 1)		R7 K14 K17 Q18 R20 I22 P23 W25 I26 M28 T30 I34 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tor, PDBe:7tor, PDBj:7tor
PDBsum7tor
PubMed35589706
UniProtG1TTN1

[Back to BioLiP]