Structure of PDB 7toq Chain AL35 Binding Site BS02

Receptor Information
>7toq Chain AL35 (length=122) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA
Ligand information
>7toq Chain A58S (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>.............>>>..)...>>
>....<<<..>>><<<<<<<<.......>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7toq Ribosome inhibition by C9ORF72-ALS/FTD-associated poly-PR and poly-GR proteins revealed by cryo-EM.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		A2 K3 K5 R7 S45 R48 R51 K52 A55 R56 L58 T59 N62 Q63 K66 L81 R84 P85 K86 T88 R89 R92
Binding residue
(residue number reindexed from 1)		A1 K2 K4 R6 S44 R47 R50 K51 A54 R55 L57 T58 N61 Q62 K65 L80 R83 P84 K85 T87 R88 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7toq, PDBe:7toq, PDBj:7toq
PDBsum7toq
PubMed35589706
UniProtG1SIT5|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)

[Back to BioLiP]