Structure of PDB 7top Chain AL05 Binding Site BS02

Receptor Information
>7top Chain AL05 (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>7top Chain A5S (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7top Ribosome inhibition by C9ORF72-ALS/FTD-associated poly-PR and poly-GR proteins revealed by cryo-EM.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		A2 S10 S13 S14 T18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 K58 I61 Q63 I65 I69 T70 D72 V74 Y79 G91 N94 W95 Q151 R152 T154 T155 A157 R158 Y198 H203 Y207 E210 R218 E221 F223 F253 K258 K259 F260 K262 Q264 Y265 E268 S269 Y272 R273 Q274 K276 L277 K279 R282 R285 V286 K289
Binding residue
(residue number reindexed from 1)		A1 S9 S12 S13 T17 F19 R20 R21 R23 T27 Y29 R32 R49 R53 T55 N56 K57 I60 Q62 I64 I68 T69 D71 V73 Y78 G90 N93 W94 Q150 R151 T153 T154 A156 R157 Y197 H202 Y206 E209 R217 E220 F222 F252 K257 K258 F259 K261 Q263 Y264 E267 S268 Y271 R272 Q273 K275 L276 K278 R281 R284 V285 K288
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 22:09:08 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7top', asym_id = 'AL05', bs = 'BS02', title = 'Ribosome inhibition by C9ORF72-ALS/FTD-associated poly-PR and poly-GR proteins revealed by cryo-EM.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7top', asym_id='AL05', bs='BS02', title='Ribosome inhibition by C9ORF72-ALS/FTD-associated poly-PR and poly-GR proteins revealed by cryo-EM.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '7top', asym_id = 'AL05'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='7top', asym_id='AL05')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>