Structure of PDB 4v9s Chain AL Binding Site BS02

Receptor Information
>4v9s Chain AL (length=122) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v9s The antibiotics dityromycin and GE82832 bind protein S12 and block EF-G-catalyzed translocation.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R34 V36 R59 H80 V82
Binding residue
(residue number reindexed from 1)		R30 V32 R55 H76 V78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9s, PDBe:4v9s, PDBj:4v9s
PDBsum4v9s
PubMed24412368
UniProtQ5SHN3|RS12_THET8 Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]