Structure of PDB 8q5i Chain AK Binding Site BS02

Receptor Information

>8q5i Chain AK (length=86) Species: 5476 (Candida albicans)

GKGTPSLGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKMRSHNWAL
KAKRRRTTGTGRMAYLKHVTRRFKNGFQTGVAKAQT

Ligand information

>8q5i Chain 4 (length=158)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguuu

.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
• Resolution: 2.45 Å
• Binding residue (original residue number in PDB): R21 C22 V29 T59 G60 G62 R63 M64 Y66 L67 K68 V70 R72 F74 K75 N76 Q79 G81 V82 A83 Q86
• Binding residue (residue number reindexed from 1): R20 C21 V28 T58 G59 G61 R62 M63 Y65 L66 K67 V69 R71 F73 K74 N75 Q78 G80 V81 A82 Q85

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
• PDBsum: 8q5i
• UniProt: A0A1D8PF45|RL37B_CANAL Large ribosomal subunit protein eL37 (Gene Name=RPL37B)