Structure of PDB 8cre Chain AK Binding Site BS02

Receptor Information
>8cre Chain AK (length=86) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKGTPSLGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKMRSHNWAL
KAKRRRTTGTGRMAYLKHVTRRFKNGFQTGVAKAQT
Ligand information
>8cre Chain 4 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguu
.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R21 C22 G23 V29 Y39 A42 T59 G60 T61 G62 R63 M64 Y66 L67 K68 R72 F74 K75 N76 Q79 G81 V82 A83 A85
Binding residue
(residue number reindexed from 1)		R20 C21 G22 V28 Y38 A41 T58 G59 T60 G61 R62 M63 Y65 L66 K67 R71 F73 K74 N75 Q78 G80 V81 A82 A84
External links
PDB RCSB:8cre, PDBe:8cre, PDBj:8cre
PDBsum8cre
PubMed
UniProtA0A1D8PF45|RL37B_CANAL Large ribosomal subunit protein eL37 (Gene Name=RPL37B)

[Back to BioLiP]