Structure of PDB 8c3a Chain AK Binding Site BS02

Receptor Information

>8c3a Chain AK (length=86) Species: 5476 (Candida albicans)

GKGTPSLGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKMRSHNWAL
KAKRRRTTGTGRMAYLKHVTRRFKNGFQTGVAKAQT

Ligand information

>8c3a Chain 4 (length=157)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauaugaauugcagauauucgugaaucaucgaaucu
uugaacgcacauugcgcccucugguauuccggagggcaugccuguuugag
cgucguu

.........................................<<<<<<.((
.....>>>.....<.<<<<.....))............>>.>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8c3a New crystal system to promote screening for new eukaryotic inhibitors
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): R21 C22 G23 V29 Y39 A42 T59 G60 T61 G62 R63 M64 A65 Y66 L67 K68 R72 F74 K75 N76 Q79 G81 V82 A83 A85
• Binding residue (residue number reindexed from 1): R20 C21 G22 V28 Y38 A41 T58 G59 T60 G61 R62 M63 A64 Y65 L66 K67 R71 F73 K74 N75 Q78 G80 V81 A82 A84

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
• PDBsum: 8c3a
• UniProt: A0A1D8PF45|RL37B_CANAL Large ribosomal subunit protein eL37 (Gene Name=RPL37B)